PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0394s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 556aa    MW: 61956.2 Da    PI: 4.3682
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0394s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-52101371128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             l+pGfrFhPtdeelv +yLk+kv++k++++ e+i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky +g+++nrat++gyWk+
  SapurV1A.0394s0050.1.p  10 LAPGFRFHPTDEELVRYYLKRKVTNKPFRF-EAISVTDIYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYGNGSKTNRATEKGYWKT 95 
                             579*************************99.89**************95347777888***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd+++ + ++++vg+kktLv+++grap+g++++Wvmheyrl
  SapurV1A.0394s0050.1.p  96 TGKDRSIRQ-NSQVVGMKKTLVYHQGRAPRGQRSNWVMHEYRL 137
                             ********9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-597159IPR003441NAC domain
PROSITE profilePS5100557.60410159IPR003441NAC domain
PfamPF023654.0E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MGRSDSSTSL APGFRFHPTD EELVRYYLKR KVTNKPFRFE AISVTDIYKS EPWDLPDKSK  60
LKSRDLEWYF FSMLDKKYGN GSKTNRATEK GYWKTTGKDR SIRQNSQVVG MKKTLVYHQG  120
RAPRGQRSNW VMHEYRLVDE ELEKAGIADA FVLCRIFQKS GTGPKNGEQY GAPFIEEEWD  180
DDEVPLLPGE EEMVLTEEAP VGDDAYLEMN ELGQNFDTGI TSENTALPQN FYYGEASNYV  240
EQPRDFSEDD LKPMLRGAEN RHGPSVPAEE NLDLPGQYEM NAVKNEYATE HINNVNAVDE  300
NYLFDESYLD ALNNLPPSEG LFLEANDLSK PVEPETGGDS SGFDMLEEYL NFFDADDENM  360
SFDPSDFLAS DTAVSNQQPP PQENVKGGSE EVLKAIQKPL ETLGNVDPSS SKQKLEAMEF  420
DSDFKYPFIK QASHMLGKIP APPALASEFP SKDAALRLQS ASSSSVHVTA GMIRIESMSL  480
GGNGTDWSFG KNGNVNIILS LGLPQQGGPA SMVPMTSVFS GKAEPVVSWG WLFLMLFWIL  540
ILSVSYKIGT CICAK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-45616513171NAC domain-containing protein 19
4dul_A6e-45616513171NAC domain-containing protein 19
1ut7_B6e-45616513171NO APICAL MERISTEM PROTEIN
1ut7_A6e-45616513171NO APICAL MERISTEM PROTEIN
1ut4_B6e-45616513171NO APICAL MERISTEM PROTEIN
1ut4_A6e-45616513171NO APICAL MERISTEM PROTEIN
3swp_D7e-45616516174NAC domain-containing protein 19
3swp_C7e-45616516174NAC domain-containing protein 19
3swp_B7e-45616516174NAC domain-containing protein 19
3swp_A7e-45616516174NAC domain-containing protein 19
3swm_D7e-45616516174NAC domain-containing protein 19
3swm_C7e-45616516174NAC domain-containing protein 19
3swm_B7e-45616516174NAC domain-containing protein 19
3swm_A7e-45616516174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011031618.10.0PREDICTED: NAC domain-containing protein 78-like isoform X1
SwissprotQ84K001e-177NAC78_ARATH; NAC domain-containing protein 78
TrEMBLU5G4S60.0U5G4S6_POPTR; Uncharacterized protein
STRINGPOPTR_0008s03170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-168NAC domain containing protein 2